AADEVGAEGKLNDHFPLVVWQTGSGTQTNMNVNEVLSNR

Found in: current ncORF study

peptide details
peptide_group N
genome_location_chr chr1|-|241512042|241512139|241513596|241513614
protein_id_best ALL_00332725.p1
gene_id_best XLOC_015081
psms_q_value_min 0.000001
peptides_q_value_min 0.000013
relaxed 1
stringent 1
strictest 1
relaxed_PepQuery 1
stringent_PepQuery 1
strictest_PepQuery 1
GENCODE_location_group All_transcript_coding
genome_loc_count 1
spectrums_count_relaxed 59
PRIDE projects and raw files of the MS spectra

PXD008722

Quantitative proteomics of human heart samples collected in vivo reveal the remodeled protein landscape of dilated left atrium without atrial fibrillation.

instruments: Q Exactive

IDshort activationMethod #spectrum #PSM #PSM(q<0.01) scan ID
11HU HCD 32320 30236 12491 31432

PXD019483

The Proteome Landscape of the Kingdoms of Life

instruments: Q Exactive

IDshort activationMethod #spectrum #PSM #PSM(q<0.01) scan ID
136A HCD 180018 163020 20181 194337

PXD019826

The mitochondrial transporter SFXN1 is critical for Complex III integrity and cellular metabolism

instruments: Orbitrap Fusion Lumos

IDshort activationMethod #spectrum #PSM #PSM(q<0.01) scan ID
13A0 HCD 43208 38812 8777 25665
13A2 HCD 52298 47228 10987 22877

PXD018383

Proximal Biotinylation Based Combinatory Approach for Isolating Plasma Membrane Proteins

instruments: Q Exactive

IDshort activationMethod #spectrum #PSM #PSM(q<0.01) scan ID
1AVD HCD 9852 9107 1775 11809
1AVY HCD 15288 14492 4434 16839
1AW8 HCD 13515 12369 2840 14627

PXD009952

Maximally-multiplexed proteome quantification platform for isotopic metabolic and chemical labeling

instruments: Orbitrap Fusion Lumos, Q Exactive

IDshort activationMethod #spectrum #PSM #PSM(q<0.01) scan ID
1UPN HCD 140203 122120 25300 90723
1UPO HCD 139353 119004 23165 90898

PXD014087

Proteomics analysis of pancreatic cancer cell line (MiaPaCa-2)

instruments: Q Exactive

IDshort activationMethod #spectrum #PSM #PSM(q<0.01) scan ID
28S8 HCD 16632 15388 3642 12023
28T2 HCD 17333 15540 3580 12464
28T3 HCD 17797 16085 3868 12727
28S9 HCD 17128 15876 3851 12319

PXD008918

Proteomics analysis of monocyte-derived hepatocyte-like cells identifies integrin beta 3 as a specific biomarker for drug-induced liver injury by diclofenac

instruments: Q Exactive

IDshort activationMethod #spectrum #PSM #PSM(q<0.01) scan ID
2B00 HCD 61813 57848 17083 52967
2B02 HCD 62368 58447 17309 53533
2B03 HCD 62616 58476 17448 53446

PXD014945

Cerebrospinal Fluid-Derived Microvesicles from Sleeping Sickness Patients Alter Protein Expression in Human Astrocytes

instruments: Orbitrap Fusion Lumos

IDshort activationMethod #spectrum #PSM #PSM(q<0.01) scan ID
3L8L HCD 70726 61951 19819 41320
3L8J HCD 72233 63744 21463 41404
3L8G HCD 73465 63909 21543 41284
3L8M HCD 69027 59763 19334 41250
3L8E HCD 71899 63636 21077 41364

PXD008333

Identification of a damaging variant rs35033974 associated with idiopathic male infertility through degradation of TEX101 protein and its transient interactome

instruments: Q Exactive

IDshort activationMethod #spectrum #PSM #PSM(q<0.01) scan ID
3OCA HCD 34284 30505 9611 26701

PXD006675

Region and cell-type resolved quantitative proteomic map of the human heart and its application to atrial fibrillation

instruments: Q Exactive

IDshort activationMethod #spectrum #PSM #PSM(q<0.01) scan ID
43WP HCD 63731 58821 17854 54203
43XL HCD 67450 62432 17894 58150
44CN HCD 86332 79651 19168 73430

PXD001327

Proteome profiling of breast cancer biopsies reveals a wound healing signature of cancer-associated fibroblasts - ZR-75-1 breast cancer cells

instruments: Q Exactive

IDshort activationMethod #spectrum #PSM #PSM(q<0.01) scan ID
80L HCD 53357 50135 19799 39368

PXD001416

Comprehensive Assessment of Proteins Regulated by Dexamethasone Reveals Novel Effects in Primary Human Peripheral Blood Mononuclear Cells - Cytoplasmic Proteins of Untreated Cells

instruments: Q Exactive

IDshort activationMethod #spectrum #PSM #PSM(q<0.01) scan ID
8B1 HCD 47801 44505 17997 33250
8AY HCD 42602 39459 14777 31456
8AT HCD 47707 45030 18479 34332
8AI HCD 45401 42861 14868 37946
8B0 HCD 42753 39584 14797 31201
8AZ HCD 47842 44445 18086 33517
8AS HCD 47990 45177 18436 34161
8AJ HCD 45652 43135 14849 38071

PXD001419

Comprehensive Assessment of Proteins Regulated by Dexamethasone Reveals Novel Effects in Primary Human Peripheral Blood Mononuclear Cells - cytoplasmic proteins of inflammatory stimulated cells

instruments: Q Exactive

IDshort activationMethod #spectrum #PSM #PSM(q<0.01) scan ID
8CA HCD 48387 44980 18049 33813
8CB HCD 47994 44669 17872 34330
8C3 HCD 48573 46186 21731 34022
8BV HCD 49870 47322 19615 41647
8C2 HCD 48544 46249 21786 33886
8CC HCD 46369 42821 14405 32747
8CD HCD 46318 42627 14155 33145

PXD001422

Comprehensive Assessment of Proteins Regulated by Dexamethasone Reveals Novel Effects in Primary Human Peripheral Blood Mononuclear Cells - cytoplasmic proteins of dexamethasone-treated inflammatory stimulated cells

instruments: Q Exactive

IDshort activationMethod #spectrum #PSM #PSM(q<0.01) scan ID
8DL HCD 51220 48561 20842 36090
8DS HCD 46828 44049 18515 34009

PXD003947

Quest for missing proteins in the human spermatozoa: an update

instruments: Q Exactive

IDshort activationMethod #spectrum #PSM #PSM(q<0.01) scan ID
PC8 HCD 20672 19861 10149 20596
PCN HCD 20298 19484 10142 19605

PXD004424

Proteomic and bioinformatic characterization of extracellular vesicles released from human primary macrophages upon influenza A infection

instruments: Q Exactive

IDshort activationMethod #spectrum #PSM #PSM(q<0.01) scan ID
W8H HCD 24728 20323 4783 17361

Note:

PRIDE changed the names for some raw files. For example, file with link "http://ftp.ebi.ac.uk/pride/data/archive/2020/06/PXD019483/20180920_QX3_JoMu_SA_LC12-7_uPAC200cm_HeLa+iRT_2-1verdunnt_F7.raw" were changed to "http://ftp.ebi.ac.uk/pride/data/archive/2020/06/PXD019483/20180920_QX3_JoMu_SA_LC12-7_uPAC200cm_HeLaiRT_2-1verdunnt_F7.raw". You may need to find the correct url by visiting the Project link directly. In this example, the project link is "http://ftp.ebi.ac.uk/pride/data/archive/2020/06/PXD019483"